PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14002_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 250aa    MW: 28178.9 Da    PI: 8.0875
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14002_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48e-193077148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          rg+WT+eEd ll+++++ +G g+W++ a++ g++Rt+k+c++rw++yl
  cra_locus_14002_iso_2_len_1066_ver_3 30 RGPWTAEEDTLLIHYIASHGEGRWNLLAKRSGLKRTGKSCRLRWLNYL 77
                                          89********************************************97 PP

2Myb_DNA-binding51.32.7e-1683126146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rg+ T++E++ ++d++ ++G++ W++Ia++++ gRt++++k++w++
  cra_locus_14002_iso_2_len_1066_ver_3  83 RGNLTPQEQLVILDLHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 126
                                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2332577IPR017930Myb domain
SuperFamilySSF466896.79E-3128124IPR009057Homeodomain-like
SMARTSM007171.1E-162979IPR001005SANT/Myb domain
PfamPF002492.1E-173077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-233184IPR009057Homeodomain-like
CDDcd001671.19E-123277No hitNo description
PROSITE profilePS5129424.65178132IPR017930Myb domain
SMARTSM007175.0E-1482130IPR001005SANT/Myb domain
PfamPF002491.2E-1483126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2385131IPR009057Homeodomain-like
CDDcd001671.55E-1087126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
XSSSSSSLSK TTSSSSSSDD DGTGAGGLRR GPWTAEEDTL LIHYIASHGE GRWNLLAKRS  60
GLKRTGKSCR LRWLNYLKPD VKRGNLTPQE QLVILDLHSK WGNRWSKIAQ HLPGRTDNEI  120
KNYWRTRVQK QARHLKIDSN STQFQELIRC VWMPRLIQKI QLDQSSSWDS SLINSASPDH  180
QVLCNSSSAA AVAAQQEELG ARILDQNVDF FQSQGEINYN VDNNSSYDMD AFSLQGPFDI  240
YNGSLDQNNW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27241321108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534590.25e-90PREDICTED: myb-related protein 305, partial
RefseqXP_008240255.13e-89PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE19e-66MY108_ARATH; Transcription factor MYB108
TrEMBLB9T8M16e-90B9T8M1_RICCO; DNA binding protein, putative (Fragment)
STRINGVIT_17s0000g03560.t014e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154